[Ala11,22,28]-VIP (human, bovine, porcine, rat) | DNA

Product Name :
[Ala11,22,28]-VIP (human, bovine, porcine, rat)

CAS NO. :
291524-04-4

Formula :
C139H231N43O39S1

Molecular Weight::
3160.65

Target:

Serial Number:
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2

Short serial number :
HSDAVFTDNYARLRKQMAVKKALNSILA-NH2

Purity:
95%

Description :
(Ala11.22.28)-VIP (human, mouse, rat), a highly selective human VPAC1 receptor agonist, shows a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than VPAC2 receptors. It is a valid pharmacological tool for characterizing VPAC1 receptor-mediated events.

References:
[1]. Activation of VPAC1 receptors aggravates early atherosclerosis in hypercholesterolemic apolipoprotein E-deficient mice. [2]. Cutting edge: vasoactive intestinal peptide acts as a potent suppressor of inflammation in vivo by trans-deactivating chemokine receptors.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
BRCA1 Rabbit pAb supplier
AMPK alpha Rabbit mAb custom synthesis
RBPJK Antibody: RBPJK Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 56 kDa, targeting to RBPJK. It can be used for WB assays with tag free, in the background of Human.

Author: DNA_ Alkylatingdna

Related Posts