Share this post on:

Product Name :
β-Endorphin (human)

CAS NO. :
61214-51-5

Formula :
C158H251N39O46S1

Molecular Weight::
3464.98

Target:

Serial Number:
Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu

Short serial number :
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Purity:
95%

Description :
β-Endorphin, human is a prominent endogenous peptide existing in the hypophysis cerebri and hypothalamus. β-Endorphin, human is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor.

References:
[1].Distinct roles of exogenous opioid agonists and endogenous opioid peptides in the peripheral control of neuropathy-triggered heat pain. [2]. Oxidative stress via hydrogen peroxide affects proopiomelanocortin peptides directly in the epidermis of patients with vitiligo. [3]. Melanocortins mimic the effects of leptin to restore reproductive function in lean hypogonadotropic ewes.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Vimentin Antibody
VASP Antibody
MAPK14 Antibody: MAPK14 Antibody is a non-conjugated and Mouse origined monoclonal antibody about 41 kDa, targeting to MAPK14. It can be used for WB,ICC,IHC-P assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna