LL – 37, Antimicrobial Peptide, human | DNA

Product Name :
LL – 37, Antimicrobial Peptide, human

CAS NO. :
154947-66-7

Formula :

Molecular Weight::
4493.37

Target:
Bacterial

Serial Number:
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Short serial number :
[LL-37, 37 aa]

Purity:
≥95%

Description :
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

References:
[1]. Dürr UH, et al. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006 Sep;1758(9):1408-25. [2]. Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface. Invest Ophthalmol Vis Sci. 2006 Jun;47(6):2369-80. [3]. Hou M, et al. Antimicrobial peptide LL-37 and IDR-1 ameliorate MRSA pneumonia in vivo. Cell Physiol Biochem. 2013;32(3):614-23.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
RelB Antibody
HDAC10 Antibody
Cyclin A1 Antibody: Cyclin A1 Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 52 kDa, targeting to Cyclin A1. It can be used for WB,IHC-F,IHC-P,ICC/IF,ELISA assays with tag free, in the background of Human, Mouse, Rat, Monkey.

Author: DNA_ Alkylatingdna

Related Posts