Share this post on:

Product Name :
rec IGF-II (1-67) (human)

CAS NO. :
96081-16-2

Formula :
C24H36N4O9

Molecular Weight::
524.564

Target:
others

Serial Number:
Ala-Tyr-Arg-Pro-Ser-Glu-Thr-Leu-Cys-Gly-Gly-Glu-Leu-Val-Asp-Thr-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Ser-Arg-Pro-Ala-Ser-Arg-Val-Ser-Arg-Arg-Ser-Arg-Gly-Ile-Val-Glu-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Ala-Leu-Leu-Glu-Thr-Tyr-Cys-Ala-Thr-Pro

Short serial number :
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Purity:
≥95%

Description :
approx. ED₅₀ = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

References:
[1].Inhibition of proliferation in human MNNG/HOS osteosarcoma and SK-ES-1 Ewing sarcoma cell lines in vitro and in vivo by antagonists of growth hormone-releasing hormone: effects on insulin-like growth factor II. [2].Effect of mild hypoinsulinemia on renal hypertrophy: growth hormone/insulin-like growth factor I system in mild streptozotocin diabetes. [3].Zinc alters the kinetics of IGF-II binding to cell surface receptors and binding proteins.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
KMT6/EZH2 Antibody
cIAP2 Antibody (YA795)
EGFR Antibody (YA775): EGFR Antibody (YA775) is a non-conjugated and Mouse origined monoclonal antibody about 134 kDa, targeting to EGFR (6H11). It can be used for WB,ICC/IF,IP assays with tag free, in the background of Human, Monkey.

Share this post on:

Author: DNA_ Alkylatingdna