Share this post on:

Product Name :
GHRF (1-44), human

CAS NO. :
83930-13-6

Formula :
C215H358N72O66S

Molecular Weight::
5039.7

Target:
GnRH Receptor

Serial Number:
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Short serial number :
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Purity:
≥95%

Description :
Growth Hormone Releasing FactorGHRF (1-44), human Overview Properties Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-ATF2 (Thr71) Antibody
Phospho-PERK (Thr982) Antibody
NIS Antibody: NIS Antibody is an unconjugated, approximately 68 kDa, rabbit-derived, anti-NIS polyclonal antibody. NIS Antibody can be used for: WB, ELISA, IHC-P, IHC-F, IF expriments in mouse, rat, and predicted: human background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna