Share this post on:

Product Name :
Helospectin II

CAS NO. :
93585-83-2

Formula :
C180H288N46O57

Molecular Weight::
4008.58

Target:
others

Serial Number:
His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser

Short serial number :
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS

Purity:
≥95%

Description :
Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

References:
[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
STAT2 Antibody (YA057)
NMDAR1 Antibody
Cyclin D1 Antibody (YA485): Cyclin D1 Antibody (YA485) is a non-conjugated and Rabbit origined monoclonal antibody about 34 kDa, targeting to Cyclin D1. It can be used for WB,ICC/IF,IHC-P,IP assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna