Share this post on:

Product Name :
Exendin 4 (3-39)

CAS NO. :
196109-31-6

Formula :
C176H272N46O58S

Molecular Weight::
3992.47

Target:
GCGR

Serial Number:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Short serial number :
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Purity:
≥95%

Description :
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis.

References:
[1]. David Parkes, et al. Pharmacokinetic actions of exendin-4 in the rat: Comparison with glucagon-like peptide-1. (2001), 53(4), 260–267. [2]. Affiliations, et al. GLP-1(7-36)-amide and Exendin-4 stimulate the HPA axis in rodents and humans. Endocrinology. 2010 Jun;151(6):2629-40.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-FAK (Tyr397) Antibody
p16 Antibody
CLDN1 Antibody: CLDN1 Antibody is an unconjugated, approximately 23 kDa, rabbit-derived, anti-CLDN1 polyclonal antibody. CLDN1 Antibody can be used for: WB, ELISA, IHC-, IHC-, IF expriments in human, mouse, and predicted: rat, pig, cow, horse, rabbit, sheep, guinea pig background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna