Gastric Inhibitory Polypeptide (1-30) (porcine) | DNA

Product Name :
Gastric Inhibitory Polypeptide (1-30) (porcine)

CAS NO. :
134875-67-5

Formula :
C162H244N40O48S

Molecular Weight::
3552.1

Target:
Insulin Receptor

Serial Number:
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys

Short serial number :
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK

Purity:
≥95%

Description :
Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin.

References:
[1]. Krarup T, et al. Effect of porcine gastric inhibitory polypeptide on beta-cell function in type I and type II diabetes mellitus. Metabolism. 1987 Jul;36(7):677-82. [2]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
HSP70 Antibody (YA728)
TrkA Antibody
Filamin A Antibody: Filamin A Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 281 kDa, targeting to Filamin A. It can be used for WB,ICC/IF,IHC-P,FC assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts