Share this post on:

Product Name :
GIP, porcine

CAS NO. :
11063-17-5

Formula :
C225H342N60O66S

Molecular Weight::
4975.66

Target:
Insulin Receptor

Serial Number:
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Short serial number :
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Purity:
≥95%

Description :
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.

References:
[1]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-c-Jun (Ser243) Antibody
PKC gamma Antibody
Ku80 Antibody: Ku80 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 83 kDa, targeting to Ku80. It can be used for WB,ICC/IF,IHC-P,IP assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna