GIP (1 – 30), porcine, amide | DNA_ Alkylatingdna-alkylating.com

Product Name :
GIP (1 – 30), porcine, amide

CAS NO. :
134846-93-8

Formula :
C162H245N41O47S

Molecular Weight::
3551.07

Target:
Insulin Receptor

Serial Number:
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2

Short serial number :
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2

Purity:
≥95%

Description :
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.

References:
[1]. L S Hansen, et al. N-terminally and C-terminally truncated forms of glucose-dependent insulinotropic polypeptide are high-affinity competitive antagonists of the human GIP receptor. Br J Pharmacol. 2016 Mar;173(5):826-38.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Acetyl CoA Carboxylase 1 (ACC1) Antibody
Gli1 Antibody
Alpha-ENaC Antibody: Alpha-ENaC Antibody is an unconjugated, approximately 76 kDa, rabbit-derived, anti-Alpha-ENaC polyclonal antibody. Alpha-ENaC Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, mouse, rat, and predicted: dog, pig, cow, horse, sheep background without labeling.

Author: DNA_ Alkylatingdna

Related Posts