Share this post on:

Product Name :
Galanin (swine)

CAS NO. :
88813-36-9

Formula :
C146H213N43O40

Molecular Weight::
3210.55

Target:
Neuropeptide Y Receptor

Serial Number:
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2

Short serial number :
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2

Purity:
≥95%

Description :
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively.

References:
[1]. Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21(3):109-117. [2]. Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229(2):233-237.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Glutamine Synthetase Antibody (YA751)
Phospho-Histone H2A.X (Ser139) Antibody (YA191)
GSDME Antibody: GSDME Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 55 kDa, targeting to GSDME. It can be used for WB,IP assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna