Share this post on:

Product Name :
Galanin, human

CAS NO. :
119418-04-1

Formula :
C139H210N42O43

Molecular Weight::
3157.44

Target:
Neuropeptide Y Receptor

Serial Number:
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser

Short serial number :
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Purity:
≥95%

Description :
Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.

References:
[1]. Hua XY, et al. Galanin acts at GalR1 receptors in spinal antinociception: synergy with morphine and AP-5. J Pharmacol Exp Ther. 2004 Feb;308(2):574-82. [2]. Schmidt WE, et al. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11435-9.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Ctip2 Antibody
BRCA1 Antibody
Hsp60 Antibody (YA730): Hsp60 Antibody (YA730) is a non-conjugated and Mouse origined monoclonal antibody about 61 kDa, targeting to Hsp60 (6C8). It can be used for WB,ICC/IF,IP assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna