[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

Product Name :
[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

CAS NO. :
215777-46-1

Formula :
C149H226N40O46

Molecular Weight::
3313.7

Target:
GCCR

Serial Number:
His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Short serial number :
HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity:
≥95%

Description :
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.

References:
[1]. J Schirra, et al. Effects of glucagon-like peptide-1(7-36)amide on motility and sensation of the proximal stomach in humans. Gut. 2002 Mar;50(3):341-8.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
eIF5A Antibody
Cyclin D1 Antibody
RASA1 Antibody: RASA1 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 116 kDa, targeting to RASA1. It can be used for WB,ICC assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts