GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)

Product Name :
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)

CAS NO. :
1802086-70-9

Formula :
C165H252N44O48S

Molecular Weight::
3652.18

Target:
GLP Receptor

Serial Number:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(bio) -NH2

Short serial number :
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Lys(Biotinyl)}-NH2

Purity:
≥95%

Description :
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding to the 7-36 sequence of GLP-1.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
IL-1 alpha Antibody
SREBP1 Antibody
FSH receptor Antibody: FSH receptor Antibody is an unconjugated, approximately 78 kDa, rabbit-derived, anti-FSH receptor polyclonal antibody. FSH receptor Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, mouse, rat, and predicted: dog, pig, cow, horse, sheep, guinea pig background without labeling.

Author: DNA_ Alkylatingdna

Related Posts