NTproBNP(1-76) | DNA_ Alkylatingdna-alkylating.com

Product Name :
NTproBNP(1-76)

CAS NO. :

Formula :
C364H596N114O116S

Molecular Weight::
8457.57

Target:

Serial Number:
His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Ser-Glu-Leu-Gln-Val-Glu-Gln-Thr-Ser-Leu-Glu-Pro-Leu-Gln-Glu-Ser-Pro-Arg-Pro-Thr-Gly-Val-Trp-Lys-Ser-Arg-Glu-Val-Ala-Thr-Glu-Gly-Ile-Arg-Gly-His

Short serial number :
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGH

Purity:
≥95%

Description :
NT-proBNP is metabolized by the kidneys and is greatly affected by renal function, and ACE inhibitors/ARBs, β-blockers, adrenergic antagonists, and diuretics can reduce the concentration of NT-proBNP, so it is necessary to measure the basal level of NT-proBNP before drug treatment as a reference for diagnosis, prognosis, and efficacy evaluation.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Fatty Acid Synthase Antibody
FGFR2/CD332 Antibody
Glutathione Reductase Antibody: Glutathione Reductase Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 56 kDa, targeting to Glutathione Reductase. It can be used for WB assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts