[Des-His1, Glu9] – Glucagon (1 – 29), amide | DNA

Product Name :
[Des-His1, Glu9] – Glucagon (1 – 29), amide

CAS NO. :
110084-95-2

Formula :
C148H221N41O47S

Molecular Weight::
3358.72

Target:
GCCR

Serial Number:
Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2

Short serial number :
SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2

Purity:
≥95%

Description :
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes.

References:
[1]. Unson CG, et, al. Biological activities of des-His1[Glu9]glucagon amide, a glucagon antagonist. Peptides. 1989 Nov; 10(6): 1171-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Desmin Antibody
PI 3 Kinase p85 alpha Antibody
VEGF Receptor 2 Antibody: VEGF Receptor 2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 152 kDa, targeting to VEGF Receptor 2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Rat.

Author: DNA_ Alkylatingdna

Related Posts