Share this post on:

Product Name :
Glucagon – Like Peptide 1, (GLP – 1) amide, human

CAS NO. :

Formula :
C184H273N51O57

Molecular Weight::
4111.53

Target:

Serial Number:
His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Short serial number :
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity:
≥95%

Description :

References:
[1].J.J.Holst et al., FEBS Lett., 211, 169 (1987) [2].D.J.Drucker et al., Proc. Natl. Acad. Sci. USA, 84, 3434 (1987) [3].J.J.Meier et al., Biodrugs, 17, 93 (2003)

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
M-CSF Antibody
ERK5 Antibody
Dnmt3a Antibody: Dnmt3a Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 102 kDa, targeting to Dnmt3a. It can be used for WB,ICC/IF assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna