GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)

Product Name :
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)

CAS NO. :
161748-29-4

Formula :
C140H214N36O43

Molecular Weight::
3089.48

Target:
GCCR

Serial Number:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Short serial number :
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity:
≥95%

Description :
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor.

References:
[1]. Knudsen LB, et al. Glucagon-like peptide-1-(9-36) amide is a major metabolite of glucagon-like peptide-1-(7-36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor. Eur J Pharmacol. 1996;318(2-3):429-435. [2]. Elahi D, et al. GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. Obesity (Silver Spring). 2008;16(7):1501-1509.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
FMRP Antibody
SIRT3 Antibody
NF-κB p65 Antibody: NF-κB p65 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 65 kDa, targeting to NF-κB p65. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts