Share this post on:

Product Name :
BNP-32,rat

CAS NO. :
133448-20-1

Formula :
C146H239N47O44S3

Molecular Weight::
3453.01

Target:
Angiotensin Receptor

Serial Number:
Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge:Cys10-Cys26)

Short serial number :
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)

Purity:
≥95%

Description :
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

References:
[1]. Dickey DM, et al. Human B-type natriuretic peptide is not degraded by meprin A. Biochem Pharmacol. 2010 Oct 1;80(7):1007-11. [2]. Wellard J, et al. Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3′,5′-cyclic monophosphate in ependymal cells ex vivo. Neurosci Lett. 2006 Jan 16;392(3):187-92. [3]. Seymour AA, et al. Potentiation of brain natriuretic peptides by SQ 28,603, an inhibitor of neutral endopeptidase3.4.24.11, in monkeys and rats. J Pharmacol Exp Ther. 1992 Jul;262(1):60-70.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
APG5L Antibody
MyD88 Antibody
BRD4 Antibody: BRD4 Antibody is an antibody about 152 kDa, targeting to BRD4.

Share this post on:

Author: DNA_ Alkylatingdna