Share this post on:

Product Name :
GLP-2 (rat)

CAS NO. :
195262-56-7

Formula :
C166H256N44O56S

Molecular Weight::
3796.22

Target:
Apoptosis

Serial Number:
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Short serial number :
HADGSFSDEMNTILDNLATRDFINWLIQTKIT

Purity:
≥95%

Description :
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

References:
[1]. Avik K, et, al. Is OM-3 synergistic with GLP-2 in intestinal failure. J Surg Res. 2017 Jan; 207: 7-12. [2]. Flavio GR, et, al. Glucagon-like peptide-2: divergent signaling pathways. J Surg Res. 2004 Sep; 121(1): 5-12.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
KDM1A Antibody (YA718)
Vimentin Antibody
Retinoid X Receptor alpha Antibody: Retinoid X Receptor alpha Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 51 kDa, targeting to Retinoid X Receptor alpha. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Rat.

Share this post on:

Author: DNA_ Alkylatingdna