Share this post on:

Product Name :
GLP-2 (1-33) (human)

CAS NO. :
223460-79-5

Formula :
C165H254N44O55S

Molecular Weight::
3766.2

Target:
GCCR

Serial Number:
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Short serial number :
HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Purity:
≥95%

Description :
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

References:
[1]. Kaori Austin, et al. IGF Binding Protein-4 is Required for the Growth Effects of Glucagon-Like Peptide-2 in Murine Intestine. Endocrinology. 2015 Feb; 156(2): 429-436. [2]. Hsieh J, et al. Glucagon-Like Peptide 2 (GLP-2) Stimulates Postprandial Chylomicron Production and Postabsorptive Release of Intestinal Triglyceride Storage Pools via Induction of Nitric Oxide Signaling in Male Hamsters and Mice. Endocrinology. 2015 Oct;1

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
IKB alpha Antibody
BRCA1 Antibody (YA819)
His Tag (C-terminal) Antibody: His Tag Antibody is a non-conjugated and Rabbit origined polyclonal antibody with His-tag. It can be used for WB,IP assays.

Share this post on:

Author: DNA_ Alkylatingdna