Share this post on:

Product Name :
Glucagon – Like Peptide 1 (7 – 37)

CAS NO. :
106612-94-6

Formula :
C151H226N40O46

Molecular Weight::
3337.73

Target:
GCCR

Serial Number:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Short serial number :
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Purity:
≥95%

Description :
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

References:
[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
JNK2 Antibody
CD79a Antibody
UCP-1 Antibody: UCP-1 Antibody is an unconjugated, approximately 33 kDa, rabbit-derived, anti-UCP-1 polyclonal antibody. UCP-1 Antibody can be used for: WB, ELISA, Flow-Cyt expriments in mouse, and predicted: human, rat, dog, cow, horse, rabbit, sheep background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna