Share this post on:

Product Name :
Parstatin(human)

CAS NO. :
121545-65-1

Formula :
C191H330N64O53S3

Molecular Weight::
4467.26

Target:
Protease Activated Receptor (PAR)

Serial Number:
Met-Gly-Pro-Arg-Arg-Leu-Leu-Leu-Val-Ala-Ala-Cys-Phe-Ser-Leu-Cys-Gly-Pro-Leu-Leu-Ser-Ala-Arg-Thr-Arg-Ala-Arg-Arg-Pro-Glu-Ser-Lys-Ala-Thr-Asn-Ala-Thr-Leu-Asp-Pro-Arg

Short serial number :
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR

Purity:
95%

Description :
Parstatin is a 41-amino acid peptide, formed by proteolytic cleavage on activation of the protease activated receptor-1, with antiangiogenic properties. Parstatin (human) attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. It promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro.

References:
[1].Panagiota Zania, et al. Parstatin, the Cleaved Peptide on Proteinase-Activated Receptor 1 Activation, Is a Potent Inhibitor of Angiogenesis. J Pharmacol Exp Ther. 2009 Feb;328(2):378-89. [2].Jennifer L Strande, et al. Parstatin: A Cryptic Peptide Involved in Cardioprotection After Ischaemia and Reperfusion Injury. Cardiovasc Res. 2009 Jul 15;83(2):325-34.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
TREM2 Antibody
Alexa Fluor® 594-conjugated AffiniPure Goat Anti-Rabbit IgG H&L
Oct-4 Antibody: Oct-4 Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 39 kDa, targeting to POU5F1. It can be used for WB,IHC-P,ICC/IF,IP,ChIP assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna